(data stored in ACNUC7421 zone)

EMBL: CP001053.PE255

CP001053.PE255       Location/Qualifiers
FT   CDS             297675..298835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4251"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: cps:CPS_4049 FO synthase subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4251"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18630"
FT                   /db_xref="GOA:B2TEV9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV9"
FT                   /protein_id="ACD18630.1"
FT                   /translation="MLSRAEAIALDQVSAGELHQLMRRACRVREKAWGATVTYSRKVFI
FT                   PLTNLCRDKCGYCTFARQPDEPGAGYLAPDQVMAIARRGEALGCKEALFSLGEKPELVY
FT                   PQARAVLDALGYATTMDYVIAMSERILAETSLIPHVNAGTLTRAEIVRLKAVCGSVGLM
FT                   LENVSRRLVQRGMAHYACPDKVPVQRLRTLDMAGVERIATTTGILIGIGETWVERIDSL
FT                   LAIAELHTRHGHIQEVIVQNFRAKPGTMMATWNEPGHEDMLRTLAVARLLLPTDISLQA
FT                   PPNLAEAFEDYLDSGINDWGGISPVTADYINPERAWPAIHDVARRSHGRGLGLAERLTV
FT                   YPRYLCQPDFVGAAPARALGCQARPDGLALHQYEAMPMAASAECAA"
     MLSRAEAIAL DQVSAGELHQ LMRRACRVRE KAWGATVTYS RKVFIPLTNL CRDKCGYCTF        60
     ARQPDEPGAG YLAPDQVMAI ARRGEALGCK EALFSLGEKP ELVYPQARAV LDALGYATTM       120
     DYVIAMSERI LAETSLIPHV NAGTLTRAEI VRLKAVCGSV GLMLENVSRR LVQRGMAHYA       180
     CPDKVPVQRL RTLDMAGVER IATTTGILIG IGETWVERID SLLAIAELHT RHGHIQEVIV       240
     QNFRAKPGTM MATWNEPGHE DMLRTLAVAR LLLPTDISLQ APPNLAEAFE DYLDSGINDW       300
     GGISPVTADY INPERAWPAI HDVARRSHGR GLGLAERLTV YPRYLCQPDF VGAAPARALG       360
     CQARPDGLAL HQYEAMPMAA SAECAA                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page