(data stored in ACNUC7421 zone)

EMBL: CP001053.PE257

CP001053.PE257       Location/Qualifiers
FT   CDS             300132..301136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4253"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: rxy:Rxyl_0958 LPPG:Fo 2-phospho-L-lactate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4253"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18632"
FT                   /db_xref="GOA:B2TEW1"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010115"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW1"
FT                   /protein_id="ACD18632.1"
FT                   /translation="MRDTGYPARIVLLAGGVGGARMALGLSAELATGSLSIVANIGDDE
FT                   DFYGLRVCPDLDTLLYTLSGKVDPMQGWGVEGDNTRALGVLGELGAPVWMKLGDADMGL
FT                   HVWRTWRLAFGESLTSVMAEASARFGVPGYLLPACDAPVPTEIVCDEGPLRFQQWFVAH
FT                   RAAPPVREVRYCGAEDRCATPEVLRAIEQADLIVIAPSNPLLSIEPMLALGGLREALQT
FT                   SGAPCVAVSPLIGGKAVKGPLDRMLDDMGLPGGNAGIAKRYEGLLHGLVIHTDDAADSA
FT                   GLQARGLAVLSAETRISSCPASVRLARTLLAWVRDGLPARQSIHGEMQKEVTI"
     MRDTGYPARI VLLAGGVGGA RMALGLSAEL ATGSLSIVAN IGDDEDFYGL RVCPDLDTLL        60
     YTLSGKVDPM QGWGVEGDNT RALGVLGELG APVWMKLGDA DMGLHVWRTW RLAFGESLTS       120
     VMAEASARFG VPGYLLPACD APVPTEIVCD EGPLRFQQWF VAHRAAPPVR EVRYCGAEDR       180
     CATPEVLRAI EQADLIVIAP SNPLLSIEPM LALGGLREAL QTSGAPCVAV SPLIGGKAVK       240
     GPLDRMLDDM GLPGGNAGIA KRYEGLLHGL VIHTDDAADS AGLQARGLAV LSAETRISSC       300
     PASVRLARTL LAWVRDGLPA RQSIHGEMQK EVTI                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page