(data stored in ACNUC7421 zone)

EMBL: CP001053.PE258

CP001053.PE258       Location/Qualifiers
FT   CDS             301133..301774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4254"
FT                   /product="protein of unknown function DUF121"
FT                   /note="PFAM: protein of unknown function DUF121; KEGG:
FT                   cps:CPS_4046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4254"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18633"
FT                   /db_xref="GOA:B2TEW2"
FT                   /db_xref="InterPro:IPR002835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW2"
FT                   /protein_id="ACD18633.1"
FT                   /translation="MKTLLAIPMKAPARAKTRLAPAMDDSQRAQLAVRLFERTLAFFRR
FT                   NWPDFDVVAVTDDATQIAPLAARHGAGVLLEVCEAGLSAAAGLALQHAWTGGYERLVIV
FT                   PGDVPVWLRAEVRQMLSLSQRHGLTLAESHDGGTNFLALAPPQRFTFHYGPQSAALHTR
FT                   SGLECGLSVARCQLPFLARDIDTAEDCLVLAHARRCRRGPRLSAFNGAPP"
     MKTLLAIPMK APARAKTRLA PAMDDSQRAQ LAVRLFERTL AFFRRNWPDF DVVAVTDDAT        60
     QIAPLAARHG AGVLLEVCEA GLSAAAGLAL QHAWTGGYER LVIVPGDVPV WLRAEVRQML       120
     SLSQRHGLTL AESHDGGTNF LALAPPQRFT FHYGPQSAAL HTRSGLECGL SVARCQLPFL       180
     ARDIDTAEDC LVLAHARRCR RGPRLSAFNG APP                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page