(data stored in ACNUC7421 zone)

EMBL: CP001053.PE26

CP001053.PE26        Location/Qualifiers
FT   CDS             complement(27774..29207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4015"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcm:Bcenmc03_5007
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4015"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18401"
FT                   /db_xref="GOA:B2TE80"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE80"
FT                   /protein_id="ACD18401.1"
FT                   /translation="MASLPIDASGASPHSSAGAPALTPGVNARIDRLPATRAVWMLVLL
FT                   LSIGGWFEFYDLFFTAYVGPGLVKSGVYSTTTASFFGVSGLGAFVAASFAGLFIGTFFL
FT                   AGMADRYGRKTVFTVSLLWYSAATLIMALQSTAPAINLWRLIAGIGVGVELVTIDTYVS
FT                   ELVPKHLRGRAFAFVHLVQYTAVPSVAFLAWWLVPRTPFGLDGWRWVVIIGALGAVVVW
FT                   AIRRRLPESPRWLAQQGRAAEAEQVLQALEAKVAAQYGKPLPPAVPTVEPATTKAAFRE
FT                   IWQPPYRKRAITMLVFNLFQAIGFYGFASWVPTLLVSKGVTITHSLLYSFVIAASNPFG
FT                   PLIGMAIADRIERKTLIVLSALGIAVFGSLFAMQTSPAMLMTLGVLITLSGTLLSVGYH
FT                   AYQTELFPTRLRARAVGFVYSMSRLSAMFSGFMIAFALRHFGVSGVFALISASMVMVMG
FT                   AIGIFGPRTNHRNLDEISH"
     MASLPIDASG ASPHSSAGAP ALTPGVNARI DRLPATRAVW MLVLLLSIGG WFEFYDLFFT        60
     AYVGPGLVKS GVYSTTTASF FGVSGLGAFV AASFAGLFIG TFFLAGMADR YGRKTVFTVS       120
     LLWYSAATLI MALQSTAPAI NLWRLIAGIG VGVELVTIDT YVSELVPKHL RGRAFAFVHL       180
     VQYTAVPSVA FLAWWLVPRT PFGLDGWRWV VIIGALGAVV VWAIRRRLPE SPRWLAQQGR       240
     AAEAEQVLQA LEAKVAAQYG KPLPPAVPTV EPATTKAAFR EIWQPPYRKR AITMLVFNLF       300
     QAIGFYGFAS WVPTLLVSKG VTITHSLLYS FVIAASNPFG PLIGMAIADR IERKTLIVLS       360
     ALGIAVFGSL FAMQTSPAML MTLGVLITLS GTLLSVGYHA YQTELFPTRL RARAVGFVYS       420
     MSRLSAMFSG FMIAFALRHF GVSGVFALIS ASMVMVMGAI GIFGPRTNHR NLDEISH          477
//

If you have problems or comments...

PBIL Back to PBIL home page