(data stored in ACNUC7421 zone)

EMBL: CP001053.PE261

CP001053.PE261       Location/Qualifiers
FT   CDS             303260..304261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4257"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   pde:Pden_1120 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4257"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18636"
FT                   /db_xref="GOA:B2TEW5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022315"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW5"
FT                   /protein_id="ACD18636.1"
FT                   /translation="MQFGICFKGFVEPDRARALVRLAEAQGFDYCWFYDSHILWRESFV
FT                   AMAMCMEHTTRMRFAPCVTNPDVREWSLAASLYGSLALQSKGRIDIGLGRGDSSRRVMG
FT                   KKPASMDRVAAFTHAVKGMVRGDEVKYEDAEAPVRLPWATGYELPVWIAAYGPIALKCA
FT                   GEHGDGLILQIADPGLCKWFTDQAVAAGKDVGRDMSKYRVQAAAPAYFGDMDECIEATK
FT                   WFPAMVGNHVADIVDKYGKDSHLVPKSLTSYIEKRRGYDYSKHGQSDNPYLDFITPDVV
FT                   ESFCVLGTPDQHIEKIGKLRAAGVTQFNIYLDNGDEAQIIETYGDKIIPAFR"
     MQFGICFKGF VEPDRARALV RLAEAQGFDY CWFYDSHILW RESFVAMAMC MEHTTRMRFA        60
     PCVTNPDVRE WSLAASLYGS LALQSKGRID IGLGRGDSSR RVMGKKPASM DRVAAFTHAV       120
     KGMVRGDEVK YEDAEAPVRL PWATGYELPV WIAAYGPIAL KCAGEHGDGL ILQIADPGLC       180
     KWFTDQAVAA GKDVGRDMSK YRVQAAAPAY FGDMDECIEA TKWFPAMVGN HVADIVDKYG       240
     KDSHLVPKSL TSYIEKRRGY DYSKHGQSDN PYLDFITPDV VESFCVLGTP DQHIEKIGKL       300
     RAAGVTQFNI YLDNGDEAQI IETYGDKIIP AFR                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page