(data stored in ACNUC7421 zone)

EMBL: CP001053.PE263

CP001053.PE263       Location/Qualifiers
FT   CDS             305711..306829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4259"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein;
FT                   KEGG: reh:H16_A0850 NAD(P) transhydrogenase subunit alpha
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4259"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18638"
FT                   /db_xref="GOA:B2TEW7"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW7"
FT                   /protein_id="ACD18638.1"
FT                   /translation="MLIGIPREIREGEARVAATPETVKKYVAQGHRVIVQSGAGVRASL
FT                   RDAAYEAVGARIGTASEAMGAGLVLKVRAPEPAELAMMTPGAVLVGMLNPFDMENEVRM
FT                   VAAGIIAFALEAAPRTTRAQSMDVLSSQANIAGYKAVLVAAHHYQRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATARRLGAVIEASDVRPAVKEQIESLGAKFLDVPFLTDEERE
FT                   IAQGAGGYARPMPADWMRRQAELVHERAKQADIVITTALIPGRTAPVLLQEASVQQMKP
FT                   GSVVVDLAAAQGGNCPLTVPDEVVERHGVILVGHTNLAAMVAADASALYARNVLDFLKL
FT                   ILDKEGKLVIDRQDDIVAACLMTGQEQVDLAS"
     MLIGIPREIR EGEARVAATP ETVKKYVAQG HRVIVQSGAG VRASLRDAAY EAVGARIGTA        60
     SEAMGAGLVL KVRAPEPAEL AMMTPGAVLV GMLNPFDMEN EVRMVAAGII AFALEAAPRT       120
     TRAQSMDVLS SQANIAGYKA VLVAAHHYQR FMPMLMTAAG TVKAARVLIL GAGVAGLQAI       180
     ATARRLGAVI EASDVRPAVK EQIESLGAKF LDVPFLTDEE REIAQGAGGY ARPMPADWMR       240
     RQAELVHERA KQADIVITTA LIPGRTAPVL LQEASVQQMK PGSVVVDLAA AQGGNCPLTV       300
     PDEVVERHGV ILVGHTNLAA MVAADASALY ARNVLDFLKL ILDKEGKLVI DRQDDIVAAC       360
     LMTGQEQVDL AS                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page