(data stored in ACNUC7421 zone)

EMBL: CP001053.PE264

CP001053.PE264       Location/Qualifiers
FT   CDS             306840..307196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4260"
FT                   /product="NAD(P) transhydrogenase subunit alpha 2"
FT                   /note="KEGG: reh:H16_A0851 NAD(P) transhydrogenase subunit
FT                   alpha 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4260"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18639"
FT                   /db_xref="GOA:B2TEW8"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW8"
FT                   /protein_id="ACD18639.1"
FT                   /translation="MELVNHTVINLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAISG
FT                   IIIVGAMLAAGLTEGSVGRVAGTLAVALAAVNVFGGFLVTQRMLEMFRKKSPKAQPQAE
FT                   RQTHAGGKAAEAAR"
     MELVNHTVIN LIIFVLAIYV GYHVVWTVTP ALHTPLMAVT NAISGIIIVG AMLAAGLTEG        60
     SVGRVAGTLA VALAAVNVFG GFLVTQRMLE MFRKKSPKAQ PQAERQTHAG GKAAEAAR         118
//

If you have problems or comments...

PBIL Back to PBIL home page