(data stored in ACNUC7421 zone)

EMBL: CP001053.PE268

CP001053.PE268       Location/Qualifiers
FT   CDS             312409..313455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4265"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bur:Bcep18194_A5230 outer membrane protein, (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4265"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18643"
FT                   /db_xref="GOA:B2TEX2"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX2"
FT                   /protein_id="ACD18643.1"
FT                   /translation="MCNQATSMAIGLCASIVLACTSQATMAQSSVTLYGILDVSVQLTT
FT                   RADGQHSAINLQNYGSVPTIFGLHGSEDLGGGVSAIFELSQSFSMTNGKSGIPGDAFGW
FT                   QSYVGLKGGFGTVTAGRQFSVLFDETVMFDPTYFAAYGGQAQLNPLSDIIVNNSIKYLS
FT                   NSYGGFVFEGLISTDGVAGNFASGRTLELGMQYSRGPFNMSVALREKNGSEMETAGSSG
FT                   KTERIGVIGAAYKIGPATLLAGVERTTGDLSPVKTVIWGGGRYDVTPALQFRAAVYQTL
FT                   SKNPQTGDPTLYVAGAVYSLSVRTQTYLNVGYSRNSAHSSQTVYEYGDAPLNGANQFAV
FT                   MLGITHKF"
     MCNQATSMAI GLCASIVLAC TSQATMAQSS VTLYGILDVS VQLTTRADGQ HSAINLQNYG        60
     SVPTIFGLHG SEDLGGGVSA IFELSQSFSM TNGKSGIPGD AFGWQSYVGL KGGFGTVTAG       120
     RQFSVLFDET VMFDPTYFAA YGGQAQLNPL SDIIVNNSIK YLSNSYGGFV FEGLISTDGV       180
     AGNFASGRTL ELGMQYSRGP FNMSVALREK NGSEMETAGS SGKTERIGVI GAAYKIGPAT       240
     LLAGVERTTG DLSPVKTVIW GGGRYDVTPA LQFRAAVYQT LSKNPQTGDP TLYVAGAVYS       300
     LSVRTQTYLN VGYSRNSAHS SQTVYEYGDA PLNGANQFAV MLGITHKF                    348
//

If you have problems or comments...

PBIL Back to PBIL home page