(data stored in ACNUC7421 zone)

EMBL: CP001053.PE271

CP001053.PE271       Location/Qualifiers
FT   CDS             318663..319337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4269"
FT                   /product="ABC-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: mag:amb1293 ABC-type uncharacterized transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4269"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18646"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX5"
FT                   /protein_id="ACD18646.1"
FT                   /translation="MARFDDRSCSQQIFMINSVVDLLRKRVLVLQHAAAAACCMLVAAP
FT                   LAAHPHVWITYASVAQMHGSTLNAVQEKWTFSQGFPVSIVGDLADMPKAGSLGPRYVNI
FT                   FKQQAFDSLKGADYFTHVFVDGKPVRFGEPRNFAVSIDDGRIVYTFELPLADKVDVRLA
FT                   QVQLGIWDETFFVDFQPPPKGALPVVFDAAAPKTCTAQPLEDKAHPIFGGTIYPLSVKL
FT                   AC"
     MARFDDRSCS QQIFMINSVV DLLRKRVLVL QHAAAAACCM LVAAPLAAHP HVWITYASVA        60
     QMHGSTLNAV QEKWTFSQGF PVSIVGDLAD MPKAGSLGPR YVNIFKQQAF DSLKGADYFT       120
     HVFVDGKPVR FGEPRNFAVS IDDGRIVYTF ELPLADKVDV RLAQVQLGIW DETFFVDFQP       180
     PPKGALPVVF DAAAPKTCTA QPLEDKAHPI FGGTIYPLSV KLAC                        224
//

If you have problems or comments...

PBIL Back to PBIL home page