(data stored in ACNUC7421 zone)

EMBL: CP001053.PE274

CP001053.PE274       Location/Qualifiers
FT   CDS             complement(322022..322678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4272"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bxe:Bxe_B0606 transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4272"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18649"
FT                   /db_xref="GOA:B2TEX8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX8"
FT                   /protein_id="ACD18649.1"
FT                   /translation="MRQLCMPQGLSPEELMKLETLICSARSVQRGEALYRSGDRFDNIY
FT                   AVRSGSMKTVMTHRDGREQVTGLRLAGEALGLDGISDDVHACSALALEDSTVCIVPYTA
FT                   LKSLCREIGSMQERMHKLLGEQIVREAAQMMVLGSLSADERVAAFLLDVSERNARRGYS
FT                   SAEFNLRMTREDMGSYLGMTLETVSRTLSRFQKRGLIDTQGKHIRIVDLDGLRQV"
     MRQLCMPQGL SPEELMKLET LICSARSVQR GEALYRSGDR FDNIYAVRSG SMKTVMTHRD        60
     GREQVTGLRL AGEALGLDGI SDDVHACSAL ALEDSTVCIV PYTALKSLCR EIGSMQERMH       120
     KLLGEQIVRE AAQMMVLGSL SADERVAAFL LDVSERNARR GYSSAEFNLR MTREDMGSYL       180
     GMTLETVSRT LSRFQKRGLI DTQGKHIRIV DLDGLRQV                               218
//

If you have problems or comments...

PBIL Back to PBIL home page