(data stored in ACNUC7421 zone)

EMBL: CP001053.PE275

CP001053.PE275       Location/Qualifiers
FT   CDS             complement(323082..323549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4273"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bxe:Bxe_B0607
FT                   putative universal stress-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4273"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18650"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEX9"
FT                   /protein_id="ACD18650.1"
FT                   /translation="MYTRILVAVDGSNTSRRAFEAALALAKASGAVLQPLYVVENTPMY
FT                   FEAPGYDPSVLRNRLAEEGKELGAEFAKAMAEQGVKGELVVSEASTIDDVSVVVLKAAA
FT                   DFNADLLVMGTHGRRGFQRLILGSVAERCVRQASLPVLLIPSAAGKSGNAD"
     MYTRILVAVD GSNTSRRAFE AALALAKASG AVLQPLYVVE NTPMYFEAPG YDPSVLRNRL        60
     AEEGKELGAE FAKAMAEQGV KGELVVSEAS TIDDVSVVVL KAAADFNADL LVMGTHGRRG       120
     FQRLILGSVA ERCVRQASLP VLLIPSAAGK SGNAD                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page