(data stored in ACNUC7421 zone)

EMBL: CP001053.PE276

CP001053.PE276       Location/Qualifiers
FT   CDS             323839..324528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4274"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: atu:Atu4191 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4274"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18651"
FT                   /db_xref="GOA:B2TEY0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY0"
FT                   /protein_id="ACD18651.1"
FT                   /translation="MNERKTTGLPDKIYGDILNRIVEGEYKEGERLPTEHALAERFATS
FT                   RPTVREALARLRADGIIMTRHGSGTTVARRPDPDVRRFAPLETLSDIRRCYEFRIVTEA
FT                   GAAEQAALKADADDIAAIQHAWDQLERIIETQGIGAKDDFMFHLAVARASKNPFFITVM
FT                   SFIEEQILFSMNLSRNLSLVKTVARQRLVQEEHRAVLDAIRRKDAPGAASAMRAHLENA
FT                   LERMFGS"
     MNERKTTGLP DKIYGDILNR IVEGEYKEGE RLPTEHALAE RFATSRPTVR EALARLRADG        60
     IIMTRHGSGT TVARRPDPDV RRFAPLETLS DIRRCYEFRI VTEAGAAEQA ALKADADDIA       120
     AIQHAWDQLE RIIETQGIGA KDDFMFHLAV ARASKNPFFI TVMSFIEEQI LFSMNLSRNL       180
     SLVKTVARQR LVQEEHRAVL DAIRRKDAPG AASAMRAHLE NALERMFGS                   229
//

If you have problems or comments...

PBIL Back to PBIL home page