(data stored in ACNUC7421 zone)

EMBL: CP001053.PE277

CP001053.PE277       Location/Qualifiers
FT   CDS             complement(324705..325298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4275"
FT                   /product="autoinducer synthesis protein"
FT                   /note="PFAM: autoinducer synthesis protein; KEGG:
FT                   bxe:Bxe_B0608 putative autoinducer synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4275"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18652"
FT                   /db_xref="GOA:B2TEY1"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY1"
FT                   /protein_id="ACD18652.1"
FT                   /translation="MQTAIRIGMRQEFDNADINEMYRLRARVFHGRLGWDIPTIAGMEI
FT                   DGYDALGPHYMLIQADDGQVRGCWRLMPTEGPNMLKDTFPQLLHGAAAPVGRHIWELSR
FT                   FAIETGGEEQSFGFADLTMQAIHELVTFADQMGITRYVTVTTTPIERLLRKTGIDISRL
FT                   GSPLQIGVERAVALDIAVSPKTRTALFGPMAVAA"
     MQTAIRIGMR QEFDNADINE MYRLRARVFH GRLGWDIPTI AGMEIDGYDA LGPHYMLIQA        60
     DDGQVRGCWR LMPTEGPNML KDTFPQLLHG AAAPVGRHIW ELSRFAIETG GEEQSFGFAD       120
     LTMQAIHELV TFADQMGITR YVTVTTTPIE RLLRKTGIDI SRLGSPLQIG VERAVALDIA       180
     VSPKTRTALF GPMAVAA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page