(data stored in ACNUC7421 zone)

EMBL: CP001053.PE279

CP001053.PE279       Location/Qualifiers
FT   CDS             complement(325754..326458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4277"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; KEGG: bxe:Bxe_B0610 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4277"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18654"
FT                   /db_xref="GOA:B2TEY3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY3"
FT                   /protein_id="ACD18654.1"
FT                   /translation="MAPLLDAADEAEWFGAIAGLAETWGFDKLLIAMLPRPTIRLEDAY
FT                   VRSTYSPTWRRTYDEQGLVHIDPTVAHCATRATPLIWSPDIFKTAPQLSMYEEARAHGL
FT                   RSGITLPIHGPNQEAGMMCFVNDNNPNDEFWRHINVALPNLVLLRDLVIDTSQRHLNTH
FT                   AQTLLPKLTPRERECLKWTARGKSTWEISHILNCSEAVVNFHMKNIRTKFGVNSRRAAA
FT                   VIAAQLGLIDPG"
     MAPLLDAADE AEWFGAIAGL AETWGFDKLL IAMLPRPTIR LEDAYVRSTY SPTWRRTYDE        60
     QGLVHIDPTV AHCATRATPL IWSPDIFKTA PQLSMYEEAR AHGLRSGITL PIHGPNQEAG       120
     MMCFVNDNNP NDEFWRHINV ALPNLVLLRD LVIDTSQRHL NTHAQTLLPK LTPRERECLK       180
     WTARGKSTWE ISHILNCSEA VVNFHMKNIR TKFGVNSRRA AAVIAAQLGL IDPG             234
//

If you have problems or comments...

PBIL Back to PBIL home page