(data stored in ACNUC7421 zone)

EMBL: CP001053.PE28

CP001053.PE28        Location/Qualifiers
FT   CDS             complement(29770..31245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4017"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: KaiA binding; KEGG: bxe:Bxe_B0484 RAD55"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4017"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18403"
FT                   /db_xref="GOA:B2TE82"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE82"
FT                   /protein_id="ACD18403.1"
FT                   /translation="MTNHESQTSSRSNVETGVPGLDEILGGGLVRGGVYLLEGMAGAGK
FT                   TILSSQIGFHRVSQGEKVLYMTLIAESHDKLLGHLKGLSFFDEKAVAQQMLFVSGYHEL
FT                   MKDGLDGFLKLIASSIYDYRPSLMIIDGFRSAREFSETELSLSKFIHELNALVAAMDCT
FT                   TLLLAPLSGNEPHPEHTLVDGLIELNRYSDGMRRAREIEVHKMRARNHLMGKHFFRIAE
FT                   SGLLMFPRLEAQCAAQAGPVDLKTRLGFALPHLDGLLGGGFAQGSTTTLVGPSGVGKTL
FT                   LCLQFLAAGVARGERCLYLGFYEGPQRLIGKAEAVSIGLANAYQDGRLVIQWQPAIELA
FT                   VDELAATALATVKKIGASRIVIDGVEGFRDSALRTERFGLFLNALLHQLREACITTLLT
FT                   EELPLYADPGHARSVRVSALTENLVLLRYAETDTGLRRMISVVKQRESAHDTSLRELVI
FT                   SSQGLDVIENPASAASLHAPAGLSATLQPRRNT"
     MTNHESQTSS RSNVETGVPG LDEILGGGLV RGGVYLLEGM AGAGKTILSS QIGFHRVSQG        60
     EKVLYMTLIA ESHDKLLGHL KGLSFFDEKA VAQQMLFVSG YHELMKDGLD GFLKLIASSI       120
     YDYRPSLMII DGFRSAREFS ETELSLSKFI HELNALVAAM DCTTLLLAPL SGNEPHPEHT       180
     LVDGLIELNR YSDGMRRARE IEVHKMRARN HLMGKHFFRI AESGLLMFPR LEAQCAAQAG       240
     PVDLKTRLGF ALPHLDGLLG GGFAQGSTTT LVGPSGVGKT LLCLQFLAAG VARGERCLYL       300
     GFYEGPQRLI GKAEAVSIGL ANAYQDGRLV IQWQPAIELA VDELAATALA TVKKIGASRI       360
     VIDGVEGFRD SALRTERFGL FLNALLHQLR EACITTLLTE ELPLYADPGH ARSVRVSALT       420
     ENLVLLRYAE TDTGLRRMIS VVKQRESAHD TSLRELVISS QGLDVIENPA SAASLHAPAG       480
     LSATLQPRRN T                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page