(data stored in ACNUC7421 zone)

EMBL: CP001053.PE280

CP001053.PE280       Location/Qualifiers
FT   CDS             327147..328088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4278"
FT                   /product="Gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: bxe:Bxe_B0611 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4278"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18655"
FT                   /db_xref="GOA:B2TEY4"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY4"
FT                   /protein_id="ACD18655.1"
FT                   /translation="MTDNTRRYPDPSIRVFDPRFKPLILASASVECLYQGARWSEGPVW
FT                   FGDGRYLLWSDIPNDRILRWDEPSGTVSTFRQSSNNANGHTRDRQGRLVSCEHLTRRVT
FT                   RTEYDGSITVLAERYRGKRFNSPNDVVVKSDGSIWFSDPTFGIDGFYEGERQESELPAC
FT                   VYRIDGQSGEVTVVADDVLGPNGLAFSPDESVLYIVESRGEPHRTIRAFDVEGTGGALS
FT                   NNRVLIDAGPGTPDGFRVDVHGNLWCGWGMGTDELDGVRVFTSQGEPLGHIALPERCAN
FT                   VCFGGRHRNRLFMAASHGLYSLYVNTQGVQGG"
     MTDNTRRYPD PSIRVFDPRF KPLILASASV ECLYQGARWS EGPVWFGDGR YLLWSDIPND        60
     RILRWDEPSG TVSTFRQSSN NANGHTRDRQ GRLVSCEHLT RRVTRTEYDG SITVLAERYR       120
     GKRFNSPNDV VVKSDGSIWF SDPTFGIDGF YEGERQESEL PACVYRIDGQ SGEVTVVADD       180
     VLGPNGLAFS PDESVLYIVE SRGEPHRTIR AFDVEGTGGA LSNNRVLIDA GPGTPDGFRV       240
     DVHGNLWCGW GMGTDELDGV RVFTSQGEPL GHIALPERCA NVCFGGRHRN RLFMAASHGL       300
     YSLYVNTQGV QGG                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page