(data stored in ACNUC7421 zone)

EMBL: CP001053.PE281

CP001053.PE281       Location/Qualifiers
FT   CDS             328328..329497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4279"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bch:Bcen2424_1684 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4279"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18656"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY5"
FT                   /protein_id="ACD18656.1"
FT                   /translation="MTVSDRLALRLVSVCLAASAAFASAAHAADPVTLNIVDVAGDLQL
FT                   TQKGFEAFKAKYPNLVANLTFTNAPAPQLPGKIKAMQAAGRSDIDLVLTGTDALAAGIE
FT                   QGLWMKLLPENAAAFPGVLDKYAPGPRKMQDLAQGYGLEVAYMPAGPLLEYNPAKVSDP
FT                   PKTPEQLLQWCKAHPDKLIYARPANSGPGRTFLMGLPYVLGDKDPQDPIHGWDKTWAFL
FT                   KQLNDCIPYYPGGTSAVMKELGEGTRDMTVTVTGWDINPRALGIVPAEFRVQAFDNMTW
FT                   VNDAHYMVIPKGVPKEKIDVLYKLMNFMLEPAQQAMTYDDGYFYPGPAIKGVSVEQAPA
FT                   HSQDVLKKYGRPEYVKLLAEHPHVLPLNAAAMVAAFKKWDTEIGAQKTK"
     MTVSDRLALR LVSVCLAASA AFASAAHAAD PVTLNIVDVA GDLQLTQKGF EAFKAKYPNL        60
     VANLTFTNAP APQLPGKIKA MQAAGRSDID LVLTGTDALA AGIEQGLWMK LLPENAAAFP       120
     GVLDKYAPGP RKMQDLAQGY GLEVAYMPAG PLLEYNPAKV SDPPKTPEQL LQWCKAHPDK       180
     LIYARPANSG PGRTFLMGLP YVLGDKDPQD PIHGWDKTWA FLKQLNDCIP YYPGGTSAVM       240
     KELGEGTRDM TVTVTGWDIN PRALGIVPAE FRVQAFDNMT WVNDAHYMVI PKGVPKEKID       300
     VLYKLMNFML EPAQQAMTYD DGYFYPGPAI KGVSVEQAPA HSQDVLKKYG RPEYVKLLAE       360
     HPHVLPLNAA AMVAAFKKWD TEIGAQKTK                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page