(data stored in ACNUC7421 zone)

EMBL: CP001053.PE282

CP001053.PE282       Location/Qualifiers
FT   CDS             329586..330665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4280"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_A4846 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4280"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18657"
FT                   /db_xref="GOA:B2TEY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY6"
FT                   /protein_id="ACD18657.1"
FT                   /translation="MKHHFEQLRLDSVSRSFTNAEGQAIAALRGLDLTIQRGEFIALLG
FT                   PSGCGKSTALNCIAGLQPLTSGGIWLDDKRIDVLPPEKRGFGMVFQNYALFPHMSVLDN
FT                   VGFGLKMRGIGKSEAVRRVREALQLVQLVGHERKLPGQLSGGQQQRVAIARAIVIEPPL
FT                   ILMDEPLSNLDTKLRIEMRAEIRRIHSQLERATLYVTHDQDEALSMADRIVVMREGVVQ
FT                   QVATPKEVYTRPQNLHVARFMGYRNVAEFELEGMQGESVMVSAHGVRLLGTPMAGFNSK
FT                   RVSVALRPEDMERATPGAENAFDALVTTVEYGGRDSLLRVKTAFGDIWARVGGEFEEGE
FT                   RISLRVPPSRTLVYDAEAV"
     MKHHFEQLRL DSVSRSFTNA EGQAIAALRG LDLTIQRGEF IALLGPSGCG KSTALNCIAG        60
     LQPLTSGGIW LDDKRIDVLP PEKRGFGMVF QNYALFPHMS VLDNVGFGLK MRGIGKSEAV       120
     RRVREALQLV QLVGHERKLP GQLSGGQQQR VAIARAIVIE PPLILMDEPL SNLDTKLRIE       180
     MRAEIRRIHS QLERATLYVT HDQDEALSMA DRIVVMREGV VQQVATPKEV YTRPQNLHVA       240
     RFMGYRNVAE FELEGMQGES VMVSAHGVRL LGTPMAGFNS KRVSVALRPE DMERATPGAE       300
     NAFDALVTTV EYGGRDSLLR VKTAFGDIWA RVGGEFEEGE RISLRVPPSR TLVYDAEAV        359
//

If you have problems or comments...

PBIL Back to PBIL home page