(data stored in ACNUC7421 zone)

EMBL: CP001053.PE284

CP001053.PE284       Location/Qualifiers
FT   CDS             331540..332478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4282"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcm:Bcenmc03_1659
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4282"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18659"
FT                   /db_xref="GOA:B2TEY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEY8"
FT                   /protein_id="ACD18659.1"
FT                   /translation="MTTDHRATQPSWSASTSNDHDDGAREPERRTGHTRQRTSVPGRIW
FT                   RVLVWGAMVFFLVNVVLLIATVAVNSIATRWFGTLLPQGFTLHWYAQAWSDFQLASVLW
FT                   VTVEVVGAVVLLSVLLGVPAAYALARVQFPGKRIAMLIFLLPLMVPPVTYGIPMATVMY
FT                   KVGLAGTLSGVILANLVPALPFVILVMTPFIEQIDPNLEAAARIFGANTFRYFRYVLLP
FT                   LLVPGMLAAGLLVLVRTIGMFELTFFTAGPATQTLVVALYYAVFSTGVRAPQSIDAMAM
FT                   IYMAITLIWVLIALQFVSPTQIVSRVKEQKR"
     MTTDHRATQP SWSASTSNDH DDGAREPERR TGHTRQRTSV PGRIWRVLVW GAMVFFLVNV        60
     VLLIATVAVN SIATRWFGTL LPQGFTLHWY AQAWSDFQLA SVLWVTVEVV GAVVLLSVLL       120
     GVPAAYALAR VQFPGKRIAM LIFLLPLMVP PVTYGIPMAT VMYKVGLAGT LSGVILANLV       180
     PALPFVILVM TPFIEQIDPN LEAAARIFGA NTFRYFRYVL LPLLVPGMLA AGLLVLVRTI       240
     GMFELTFFTA GPATQTLVVA LYYAVFSTGV RAPQSIDAMA MIYMAITLIW VLIALQFVSP       300
     TQIVSRVKEQ KR                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page