(data stored in ACNUC7421 zone)

EMBL: CP001053.PE287

CP001053.PE287       Location/Qualifiers
FT   CDS             complement(335224..335679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4285"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18662"
FT                   /db_xref="InterPro:IPR021551"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEZ1"
FT                   /protein_id="ACD18662.1"
FT                   /translation="MMNSDIKKPADATQPAATSRANTAELHNDRTHDSTVDTDGKNLEA
FT                   ARIAGHSPISPDEITTSNATLTNSVPESLDGMAGFDSRVGGNHLLLALEPGYTVIDKGM
FT                   VAPQGAYSADHQYDDPRPVGSRQDRGRIHYALNHLRPTRLIELHRVK"
     MMNSDIKKPA DATQPAATSR ANTAELHNDR THDSTVDTDG KNLEAARIAG HSPISPDEIT        60
     TSNATLTNSV PESLDGMAGF DSRVGGNHLL LALEPGYTVI DKGMVAPQGA YSADHQYDDP       120
     RPVGSRQDRG RIHYALNHLR PTRLIELHRV K                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page