(data stored in ACNUC7421 zone)

EMBL: CP001053.PE297

CP001053.PE297       Location/Qualifiers
FT   CDS             complement(345059..345493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_5556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4295"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18672"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF01"
FT                   /protein_id="ACD18672.1"
FT                   /translation="MKRFLSSVLLALAAAALPLASYATALDVPLACNESGHQFIADLAD
FT                   QQLIDPKPTRVESNSINAFSPTSGANLTAYGFRVFAVVGYEKDDPMFRVGDGEPVARSA
FT                   YGVVVFGSEAKVRNAIAGTGSTAIVHRVAPLITAIFCKRS"
     MKRFLSSVLL ALAAAALPLA SYATALDVPL ACNESGHQFI ADLADQQLID PKPTRVESNS        60
     INAFSPTSGA NLTAYGFRVF AVVGYEKDDP MFRVGDGEPV ARSAYGVVVF GSEAKVRNAI       120
     AGTGSTAIVH RVAPLITAIF CKRS                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page