(data stored in ACNUC7421 zone)

EMBL: CP001053.PE298

CP001053.PE298       Location/Qualifiers
FT   CDS             345740..346441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4296"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   bxe:Bxe_B0624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4296"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18673"
FT                   /db_xref="GOA:B2TF02"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF02"
FT                   /protein_id="ACD18673.1"
FT                   /translation="MNSRPQTPINVPPPRTWDARLARRLVTPLVNTWVTPNHLTTLRLL
FT                   IGLAGALCLAHGEFAWANAGALLIVLSNFVDHTDGELARIGGKSSRIGHFYDLACDALV
FT                   TVMLFVGMGVGAGATHIAGLKIAPGVLGAVAGVAIALIFFLRMRIEEMAGKAGTRQASV
FT                   GGFETEDVLYLLPIVTLTSVVLPFVVVASIGAPLFAVWVVVDYWRVARRAASAPPVAAG
FT                   TAETRQMWASE"
     MNSRPQTPIN VPPPRTWDAR LARRLVTPLV NTWVTPNHLT TLRLLIGLAG ALCLAHGEFA        60
     WANAGALLIV LSNFVDHTDG ELARIGGKSS RIGHFYDLAC DALVTVMLFV GMGVGAGATH       120
     IAGLKIAPGV LGAVAGVAIA LIFFLRMRIE EMAGKAGTRQ ASVGGFETED VLYLLPIVTL       180
     TSVVLPFVVV ASIGAPLFAV WVVVDYWRVA RRAASAPPVA AGTAETRQMW ASE              233
//

If you have problems or comments...

PBIL Back to PBIL home page