(data stored in ACNUC7421 zone)

EMBL: CP001053.PE301

CP001053.PE301       Location/Qualifiers
FT   CDS             348294..349058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4299"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18676"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF05"
FT                   /protein_id="ACD18676.1"
FT                   /translation="MRAIILAAGLGLRLQQPPEAQFPKCLLQFDGMSLLERHLQMLETA
FT                   GVTEVVLALGFQPESVQAELERINWPHQVETVLNTRYDLGSVLTVHTVADALTRGGDVL
FT                   LMDADVLYDERILAALVAGETVNRLLIDRDFEAGDEPVKLCLKDGVPVELRKQLAVNLE
FT                   YDTIGESVGFFRFRQETAQRFAQIVAGYVDSGRANLPHEEAVRDLLLERSQVFDTADVT
FT                   GAPWIEIDFPNDVARASTEILPQLQPLVSASR"
     MRAIILAAGL GLRLQQPPEA QFPKCLLQFD GMSLLERHLQ MLETAGVTEV VLALGFQPES        60
     VQAELERINW PHQVETVLNT RYDLGSVLTV HTVADALTRG GDVLLMDADV LYDERILAAL       120
     VAGETVNRLL IDRDFEAGDE PVKLCLKDGV PVELRKQLAV NLEYDTIGES VGFFRFRQET       180
     AQRFAQIVAG YVDSGRANLP HEEAVRDLLL ERSQVFDTAD VTGAPWIEID FPNDVARAST       240
     EILPQLQPLV SASR                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page