(data stored in ACNUC7421 zone)

EMBL: CP001053.PE304

CP001053.PE304       Location/Qualifiers
FT   CDS             complement(352770..353813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4302"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: bxe:Bxe_B0630 putative
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4302"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18679"
FT                   /db_xref="GOA:B2TF08"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF08"
FT                   /protein_id="ACD18679.1"
FT                   /translation="MGSRPRFVDDLSRAASDAPGPETLNPFSDDALLDAYSRTVIGALE
FT                   RVQQAVAFIAVERRLPGQPSGRGRGSRGGTGSGFLFTPDGYLLTNSHVVHGATHITVTL
FT                   ADGAKFDADLVGDDPGSDLAVLRIGSPEPLAHVELGESSKLRVGQIAIAVGNPLGLAQT
FT                   VTTGVVSALGRSLRSNSGRMIYDVIQTDAALNPGNSGGPLINSAGQVIGVNTAIIPGAQ
FT                   AICFATAIDTAKWVIMQIFAHGRVRRAYIGVAGTTRPLSRRVQRYFGLSSESGVHVMEI
FT                   VKGSPAALGGLRTDDTIIAIDTQAVQDVDSLQRTLDASRIDRPVNVTVLRGAQRLELTL
FT                   TPVEQAS"
     MGSRPRFVDD LSRAASDAPG PETLNPFSDD ALLDAYSRTV IGALERVQQA VAFIAVERRL        60
     PGQPSGRGRG SRGGTGSGFL FTPDGYLLTN SHVVHGATHI TVTLADGAKF DADLVGDDPG       120
     SDLAVLRIGS PEPLAHVELG ESSKLRVGQI AIAVGNPLGL AQTVTTGVVS ALGRSLRSNS       180
     GRMIYDVIQT DAALNPGNSG GPLINSAGQV IGVNTAIIPG AQAICFATAI DTAKWVIMQI       240
     FAHGRVRRAY IGVAGTTRPL SRRVQRYFGL SSESGVHVME IVKGSPAALG GLRTDDTIIA       300
     IDTQAVQDVD SLQRTLDASR IDRPVNVTVL RGAQRLELTL TPVEQAS                     347
//

If you have problems or comments...

PBIL Back to PBIL home page