(data stored in ACNUC7421 zone)

EMBL: CP001053.PE31

CP001053.PE31        Location/Qualifiers
FT   CDS             complement(34544..35791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4020"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bch:Bcen2424_5633
FT                   putative 3-hydroxyphenylpropionic transporter MhpT"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4020"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18406"
FT                   /db_xref="GOA:B2TE85"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE85"
FT                   /protein_id="ACD18406.1"
FT                   /translation="MKRAGTLNSTEATTVPAASSRTGAFVTLGLCFAIALLEGLDLQSV
FT                   GVAAPRMAREFGLSVAQMGLAFSAGTFGLLPGAMFGGRLADRIGRKRVLVISACLFGLL
FT                   SIMTALVSDFHTLVIVRVLTGIGLGGALPNLIALSSEAVEPRSRGTAVSVMYCGIPFGG
FT                   VIASVIGVLSAGDTEWRHIFYVGGAGPLVLVPLLLVFLADSKAFTKASRDGQVKPAPVG
FT                   EILFGGTRGLSTVQIWVSYFCTLIVLYFLLNWLPSLMAASGLTRAQVGYVQIFFNIGGG
FT                   IGALCIGMLMDRMRSGVVVAGMYVGIIASLATLSTAHGFGALAASAFFAGMFVIGGQSV
FT                   LYALSAAFYPTAMRGTGVGAAVAVGRIGSVVGPLAAGQLLAMGRSSSTVIGASIPVTLI
FT                   AAAAALLLLRRPRADD"
     MKRAGTLNST EATTVPAASS RTGAFVTLGL CFAIALLEGL DLQSVGVAAP RMAREFGLSV        60
     AQMGLAFSAG TFGLLPGAMF GGRLADRIGR KRVLVISACL FGLLSIMTAL VSDFHTLVIV       120
     RVLTGIGLGG ALPNLIALSS EAVEPRSRGT AVSVMYCGIP FGGVIASVIG VLSAGDTEWR       180
     HIFYVGGAGP LVLVPLLLVF LADSKAFTKA SRDGQVKPAP VGEILFGGTR GLSTVQIWVS       240
     YFCTLIVLYF LLNWLPSLMA ASGLTRAQVG YVQIFFNIGG GIGALCIGML MDRMRSGVVV       300
     AGMYVGIIAS LATLSTAHGF GALAASAFFA GMFVIGGQSV LYALSAAFYP TAMRGTGVGA       360
     AVAVGRIGSV VGPLAAGQLL AMGRSSSTVI GASIPVTLIA AAAALLLLRR PRADD            415
//

If you have problems or comments...

PBIL Back to PBIL home page