(data stored in ACNUC7421 zone)

EMBL: CP001053.PE310

CP001053.PE310       Location/Qualifiers
FT   CDS             complement(359257..360294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4308"
FT                   /product="putative DedA-like transmembrane protein"
FT                   /note="KEGG: bxe:Bxe_B0639 putative DedA-like transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4308"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18685"
FT                   /db_xref="GOA:B2TF14"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF14"
FT                   /protein_id="ACD18685.1"
FT                   /translation="MVEFPSSAVSTWGGAVVFLNVLLTRLGVPIPAVPVLLFAGSAIAA
FT                   GTLSFWPVLGAAVLGALLGDGAWFTAGRLYGRKLIAALGRLSPAVDAKVDKARALFERF
FT                   GVPLVSISKFVPGLALITPPLMGTTAVDARIYAAWDVAGALAWAAFWLLGGAAAERQLH
FT                   MLLEFVKARGGTVIDILLASALLYLVFRLQQRRRERRRFREAAAAQAAGGWLRLAPPPK
FT                   VLDARPQAPSIEAPCRIPGALALDPHSPEQIDGALRAHDTVIYCICPDSATAVEITQRM
FT                   RYNGYTRIRALRGGLDAWQRRGFPVEPLALTDEPGTGNRAAASLGEARGAITLRGFAPR
FT                   STQGT"
     MVEFPSSAVS TWGGAVVFLN VLLTRLGVPI PAVPVLLFAG SAIAAGTLSF WPVLGAAVLG        60
     ALLGDGAWFT AGRLYGRKLI AALGRLSPAV DAKVDKARAL FERFGVPLVS ISKFVPGLAL       120
     ITPPLMGTTA VDARIYAAWD VAGALAWAAF WLLGGAAAER QLHMLLEFVK ARGGTVIDIL       180
     LASALLYLVF RLQQRRRERR RFREAAAAQA AGGWLRLAPP PKVLDARPQA PSIEAPCRIP       240
     GALALDPHSP EQIDGALRAH DTVIYCICPD SATAVEITQR MRYNGYTRIR ALRGGLDAWQ       300
     RRGFPVEPLA LTDEPGTGNR AAASLGEARG AITLRGFAPR STQGT                       345
//

If you have problems or comments...

PBIL Back to PBIL home page