(data stored in ACNUC7421 zone)

EMBL: CP001053.PE311

CP001053.PE311       Location/Qualifiers
FT   CDS             360587..361492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4309"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bxe:Bxe_B0640 putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4309"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18686"
FT                   /db_xref="GOA:B2TF15"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF15"
FT                   /protein_id="ACD18686.1"
FT                   /translation="MNSRYAGYLYCALAMIGVGSTVVVSKPIAAGLPPFSATALRFAIA
FT                   FPLFVLAMRWRGVRWPRLDRRDTLLVIAQAGAGSVGYTVLLISGMKLASAADAGVIAGT
FT                   LPAVSAGVAVLALGERPAPALIGAILLATAGVLVCTVHPGEFSAPHAVSSLAGNALVFL
FT                   AIVCEALFILLNRKLSTAVAPLPLSALMCGIGFAVALVPACFEKPWALPVDASALGGVL
FT                   YYALVPTVVGFVLWYAGAARISGAEAGLMTALVPVSAVALAAMVLGEPVSAAQLAGVAC
FT                   VLGAVLLATFGQLRMRRSAA"
     MNSRYAGYLY CALAMIGVGS TVVVSKPIAA GLPPFSATAL RFAIAFPLFV LAMRWRGVRW        60
     PRLDRRDTLL VIAQAGAGSV GYTVLLISGM KLASAADAGV IAGTLPAVSA GVAVLALGER       120
     PAPALIGAIL LATAGVLVCT VHPGEFSAPH AVSSLAGNAL VFLAIVCEAL FILLNRKLST       180
     AVAPLPLSAL MCGIGFAVAL VPACFEKPWA LPVDASALGG VLYYALVPTV VGFVLWYAGA       240
     ARISGAEAGL MTALVPVSAV ALAAMVLGEP VSAAQLAGVA CVLGAVLLAT FGQLRMRRSA       300
     A                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page