(data stored in ACNUC7421 zone)

EMBL: CP001053.PE319

CP001053.PE319       Location/Qualifiers
FT   CDS             368163..369011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4317"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bxe:Bxe_B0650
FT                   ABC polysaccharide efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4317"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18694"
FT                   /db_xref="GOA:B2TF23"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF23"
FT                   /protein_id="ACD18694.1"
FT                   /translation="MSFTYKHDGREESHPRAHFRDLFLLPWQQRQLIVALTRRDILSRY
FT                   RGSIMGLAWSIVQPLIMLAMYTVVFGTLLKSRWPGTDNSFQFAVILFVGLILFNFFAEC
FT                   LNRAPTIITTNANYVTKVVFPLEILPWITVASAAFHFLTSFAVWLVFALCVYGKLQWTI
FT                   VFLPALFIPLAFVGVGVGWLFAATGVYVRDLTYVTTLLSSLLMFLSPVFYALDTLTPAF
FT                   RALILTNPLTFIIEQARAVMIAGELPDFVGIAIYLSCSIGFAWICLAWFQKTREGFADV
FT                   L"
     MSFTYKHDGR EESHPRAHFR DLFLLPWQQR QLIVALTRRD ILSRYRGSIM GLAWSIVQPL        60
     IMLAMYTVVF GTLLKSRWPG TDNSFQFAVI LFVGLILFNF FAECLNRAPT IITTNANYVT       120
     KVVFPLEILP WITVASAAFH FLTSFAVWLV FALCVYGKLQ WTIVFLPALF IPLAFVGVGV       180
     GWLFAATGVY VRDLTYVTTL LSSLLMFLSP VFYALDTLTP AFRALILTNP LTFIIEQARA       240
     VMIAGELPDF VGIAIYLSCS IGFAWICLAW FQKTREGFAD VL                          282
//

If you have problems or comments...

PBIL Back to PBIL home page