(data stored in ACNUC7421 zone)

EMBL: CP001053.PE32

CP001053.PE32        Location/Qualifiers
FT   CDS             complement(36123..36623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4021"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bpd:BURPS668_A1140 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4021"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18407"
FT                   /db_xref="GOA:B2TE86"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE86"
FT                   /protein_id="ACD18407.1"
FT                   /translation="MRDRPNLLSMMSKNQNTPAEPAATRTRRSSLRLTYVIGSLDRILR
FT                   RRMTEALAPLGLTLAQFTALSVLEAKGQASNAQVAERSFITPQSANEVMNAMAARNWVS
FT                   REPDPRHGRIVLLQLTDEGRAVLRDCEQAVKTIEKQMMEGIELDAAGAVQTHLETFVRN
FT                   LRG"
     MRDRPNLLSM MSKNQNTPAE PAATRTRRSS LRLTYVIGSL DRILRRRMTE ALAPLGLTLA        60
     QFTALSVLEA KGQASNAQVA ERSFITPQSA NEVMNAMAAR NWVSREPDPR HGRIVLLQLT       120
     DEGRAVLRDC EQAVKTIEKQ MMEGIELDAA GAVQTHLETF VRNLRG                      166
//

If you have problems or comments...

PBIL Back to PBIL home page