(data stored in ACNUC7421 zone)

EMBL: CP001053.PE325

CP001053.PE325       Location/Qualifiers
FT   CDS             376678..378306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4323"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18700"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF29"
FT                   /protein_id="ACD18700.1"
FT                   /translation="MSSYGNPTMTEHTKVDFGADSVDGETASTPGPTVLEKAAPRSERM
FT                   ASNKIECNACPVLCQISEGRTGACDRYANADGRLIRVDPVVFLSRASSSSTAEANAAIE
FT                   FGASSESEVQDSAAGQALFVTGVGASSTYPDYKPAPFIVASKLDDVDMITVVTEGIFSY
FT                   CSFKVKIDTDRFLGPEQSNVRCHGEIVGHVTTAEYGSQMLSLGGVHHLTGGSKKEGRVT
FT                   CDMMLALGNKEAVELSIDGGASLVIRAGAAPIVDGVEEQRMRVGCGSATIGIFAKQWFG
FT                   HADEVVVVDDHITGVLTEHQAGRCLGMTRSGVKIRGRKSTPGRYFQVANPGTGWGGTDI
FT                   QDPLAIVEGFDPAVAKPGMRLLMVSTTGEHAQWYELDQNLVPRVAAMPDTVRRTVERIG
FT                   ENCEPSLATVLFLGGAGGSLRAGATENPVLLTRAIKQKLVNVTCGGAPAYVWPGGGITV
FT                   MVDVARMPDRSFGTVPTPAIVAPIEFTMTYDAYRDLGGHLDAVRSLESVLANGPEHTEG
FT                   APRARRTLARNPDNPWPPAMPPMLG"
     MSSYGNPTMT EHTKVDFGAD SVDGETASTP GPTVLEKAAP RSERMASNKI ECNACPVLCQ        60
     ISEGRTGACD RYANADGRLI RVDPVVFLSR ASSSSTAEAN AAIEFGASSE SEVQDSAAGQ       120
     ALFVTGVGAS STYPDYKPAP FIVASKLDDV DMITVVTEGI FSYCSFKVKI DTDRFLGPEQ       180
     SNVRCHGEIV GHVTTAEYGS QMLSLGGVHH LTGGSKKEGR VTCDMMLALG NKEAVELSID       240
     GGASLVIRAG AAPIVDGVEE QRMRVGCGSA TIGIFAKQWF GHADEVVVVD DHITGVLTEH       300
     QAGRCLGMTR SGVKIRGRKS TPGRYFQVAN PGTGWGGTDI QDPLAIVEGF DPAVAKPGMR       360
     LLMVSTTGEH AQWYELDQNL VPRVAAMPDT VRRTVERIGE NCEPSLATVL FLGGAGGSLR       420
     AGATENPVLL TRAIKQKLVN VTCGGAPAYV WPGGGITVMV DVARMPDRSF GTVPTPAIVA       480
     PIEFTMTYDA YRDLGGHLDA VRSLESVLAN GPEHTEGAPR ARRTLARNPD NPWPPAMPPM       540
     LG                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page