(data stored in ACNUC7421 zone)

EMBL: CP001053.PE327

CP001053.PE327       Location/Qualifiers
FT   CDS             379273..379863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4325"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   bxe:Bxe_B0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4325"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18702"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF31"
FT                   /protein_id="ACD18702.1"
FT                   /translation="MFEIRRVLTHVEDIFHEFGPAPAQPLRRGAIAAVMTNPFAGRYEA
FT                   KIEHAMEALKPIGFDMAQRLLAAMAVPHASIESYGKGAIVGARGELEHGALWHVPGGYA
FT                   MRELLEKNGVPTNAIVPSTKKVGAPSTALDVPLTHVNASYVRSHFDAIEVRVPGAPAAD
FT                   ELVYILVMSTGQRVHARVGGLAKEAIVGKDGLR"
     MFEIRRVLTH VEDIFHEFGP APAQPLRRGA IAAVMTNPFA GRYEAKIEHA MEALKPIGFD        60
     MAQRLLAAMA VPHASIESYG KGAIVGARGE LEHGALWHVP GGYAMRELLE KNGVPTNAIV       120
     PSTKKVGAPS TALDVPLTHV NASYVRSHFD AIEVRVPGAP AADELVYILV MSTGQRVHAR       180
     VGGLAKEAIV GKDGLR                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page