(data stored in ACNUC7421 zone)

EMBL: CP001053.PE328

CP001053.PE328       Location/Qualifiers
FT   CDS             379937..380521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4326"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   bxe:Bxe_B0657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4326"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18703"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF32"
FT                   /protein_id="ACD18703.1"
FT                   /translation="MAIKLRKLVVQVDETRIEMGQAVEPPARRAVAIAVIDNPYAGRYE
FT                   AKLDALIEAGEELGALLGNKCVEALGIAPGEAQSYGKAAIVGEAGELEHAAAILHPKLG
FT                   APLRIAVEKGAALVPSAKKMGTLGTAIDVPLGHKDAAFVRSHFDAIEARVSDAPRANEI
FT                   VVAVAVTASGRPLPRIGGLQVSEIKGEDGLR"
     MAIKLRKLVV QVDETRIEMG QAVEPPARRA VAIAVIDNPY AGRYEAKLDA LIEAGEELGA        60
     LLGNKCVEAL GIAPGEAQSY GKAAIVGEAG ELEHAAAILH PKLGAPLRIA VEKGAALVPS       120
     AKKMGTLGTA IDVPLGHKDA AFVRSHFDAI EARVSDAPRA NEIVVAVAVT ASGRPLPRIG       180
     GLQVSEIKGE DGLR                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page