(data stored in ACNUC7421 zone)

EMBL: CP001053.PE329

CP001053.PE329       Location/Qualifiers
FT   CDS             380697..382637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4327"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B0658 ABC branched chain amino acid family
FT                   transporter, fused inner membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4327"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18704"
FT                   /db_xref="GOA:B2TF33"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF33"
FT                   /protein_id="ACD18704.1"
FT                   /translation="MLSNLLVQLVNGLADASTLFLVAAGLSLIFGVTRIVNFAHGSFYM
FT                   FGIYVAYSIASRFGHTTGGFWLSVLAAALVVAVLGALVEMVVLRRIYQAPELFHLLATF
FT                   ALVLIFRDAALWLWGPEDLFGPRAPHLAGAVDFLGHPLPTYDIALIVIGPVVLLLLWYA
FT                   LTRTRWGTLVRAATQDREMLGALGINQAWLFTGVFFVGAFLAGLGGALQGPRMSANLSL
FT                   DLETIGNAFVVVVVGGMGSIPGAFIAALIIAEIKALCIGIGHVTIFGVGLSLSRFTLVA
FT                   EFVVMAVVLVVRPWGLLGRASAAVRGMAAPETPLRPAGKRLKWLAAIALLVLVLAPLAA
FT                   NAFPYMPVLLVEILIAVLFATSLHFIMGPGGMHSFGHAAYFGLGAYGAALFLKVLNLPM
FT                   EAALLLGPLLAVAGALVFGWFCVRLSGVYLAMLTLAFAQIVWSVVFQWDDVTGGSNGIL
FT                   GLWPSNWLSSPVAFYYVTLVCAVIGVWLLRKMLFSPLGYAMRASRDSVLRAEAIGIDVK
FT                   RVQWAAFVIASLFCGLAGSLYAFSKGTISPEVISVSRSVDGLVMVLLGGLQTLTGPIVG
FT                   AAVFTWLQDTVARQTDYWQALLGFAILLLVIAFPQGIVGFIRERFGDDSADSADKSAVS
FT                   PSRRAAIKEGL"
     MLSNLLVQLV NGLADASTLF LVAAGLSLIF GVTRIVNFAH GSFYMFGIYV AYSIASRFGH        60
     TTGGFWLSVL AAALVVAVLG ALVEMVVLRR IYQAPELFHL LATFALVLIF RDAALWLWGP       120
     EDLFGPRAPH LAGAVDFLGH PLPTYDIALI VIGPVVLLLL WYALTRTRWG TLVRAATQDR       180
     EMLGALGINQ AWLFTGVFFV GAFLAGLGGA LQGPRMSANL SLDLETIGNA FVVVVVGGMG       240
     SIPGAFIAAL IIAEIKALCI GIGHVTIFGV GLSLSRFTLV AEFVVMAVVL VVRPWGLLGR       300
     ASAAVRGMAA PETPLRPAGK RLKWLAAIAL LVLVLAPLAA NAFPYMPVLL VEILIAVLFA       360
     TSLHFIMGPG GMHSFGHAAY FGLGAYGAAL FLKVLNLPME AALLLGPLLA VAGALVFGWF       420
     CVRLSGVYLA MLTLAFAQIV WSVVFQWDDV TGGSNGILGL WPSNWLSSPV AFYYVTLVCA       480
     VIGVWLLRKM LFSPLGYAMR ASRDSVLRAE AIGIDVKRVQ WAAFVIASLF CGLAGSLYAF       540
     SKGTISPEVI SVSRSVDGLV MVLLGGLQTL TGPIVGAAVF TWLQDTVARQ TDYWQALLGF       600
     AILLLVIAFP QGIVGFIRER FGDDSADSAD KSAVSPSRRA AIKEGL                      646
//

If you have problems or comments...

PBIL Back to PBIL home page