(data stored in ACNUC7421 zone)

EMBL: CP001053.PE335

CP001053.PE335       Location/Qualifiers
FT   CDS             389675..390883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4333"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_B0664 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4333"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18710"
FT                   /db_xref="GOA:B2TF39"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF39"
FT                   /protein_id="ACD18710.1"
FT                   /translation="MTTRAGWISRLMVPTVLSLAALSASAQQTIKIGEINSYKAQPAFL
FT                   GPYKNGWNLALDQVNAAGGVLGKQLEVVSRDDNGNPGDTIRVAQELIAREQVQLLFGGF
FT                   LSNTGLALTDFAKQKKIFFLAAEPLTDKIVWADGNKYTYRLRPSTYMQVAMLVPEAAKL
FT                   HKKRWALVYPNYEYGQSAVATFKKLLTAAQPDVQFVAEQATPLGNVDAGAVTQAIADAK
FT                   PDAIFNVLFGADLGKFVREGNTRGLFKDRSVVSLLTGEPDYLDPLGAEAPTGWIVTGYP
FT                   WYSIDTAANKKFVDAYQAKYHDYPRLGSVVGYSALMSIAAGIKKAGSVDPDKLAAAFKG
FT                   LGVDTPFGPITYRAQDNQSTMGAYVGVTGLKDGKGVMTSYRYIDGASVQPSDAEVKKLR
FT                   PAE"
     MTTRAGWISR LMVPTVLSLA ALSASAQQTI KIGEINSYKA QPAFLGPYKN GWNLALDQVN        60
     AAGGVLGKQL EVVSRDDNGN PGDTIRVAQE LIAREQVQLL FGGFLSNTGL ALTDFAKQKK       120
     IFFLAAEPLT DKIVWADGNK YTYRLRPSTY MQVAMLVPEA AKLHKKRWAL VYPNYEYGQS       180
     AVATFKKLLT AAQPDVQFVA EQATPLGNVD AGAVTQAIAD AKPDAIFNVL FGADLGKFVR       240
     EGNTRGLFKD RSVVSLLTGE PDYLDPLGAE APTGWIVTGY PWYSIDTAAN KKFVDAYQAK       300
     YHDYPRLGSV VGYSALMSIA AGIKKAGSVD PDKLAAAFKG LGVDTPFGPI TYRAQDNQST       360
     MGAYVGVTGL KDGKGVMTSY RYIDGASVQP SDAEVKKLRP AE                          402
//

If you have problems or comments...

PBIL Back to PBIL home page