(data stored in ACNUC7421 zone)

EMBL: CP001053.PE339

CP001053.PE339       Location/Qualifiers
FT   CDS             392317..392613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4337"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bur:Bcep18194_C6638 4Fe-4S ferredoxin,
FT                   iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4337"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18714"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF47"
FT                   /protein_id="ACD18714.1"
FT                   /translation="MREKSAAECKQMPGVIAPVVDLTRCEGKGDCMEVCPENVFEIRRI
FT                   DEADYRGLDLMHRLKLRVHGMKVAYTPNAHACRSCGLCVTACPERAIKLARTA"
     MREKSAAECK QMPGVIAPVV DLTRCEGKGD CMEVCPENVF EIRRIDEADY RGLDLMHRLK        60
     LRVHGMKVAY TPNAHACRSC GLCVTACPER AIKLARTA                                98
//

If you have problems or comments...

PBIL Back to PBIL home page