(data stored in ACNUC7421 zone)

EMBL: CP001053.PE341

CP001053.PE341       Location/Qualifiers
FT   CDS             393591..394109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4339"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18716"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF41"
FT                   /protein_id="ACD18716.1"
FT                   /translation="MPEKKTIERAKSDKRAGKASSTQAGEFIKEQVDKVRAGKHGVRSA
FT                   KQAIAIGLSEARRAGVAVKSPKKGTASEATRKKAATDNAAGQHKSATKKSTESTAKRSR
FT                   AATNALKREGSAGASRAALSKQTKTAAAKRPAASRSAAAKKAAATKGAAGRSAAAKKAA
FT                   QTRASRTHH"
     MPEKKTIERA KSDKRAGKAS STQAGEFIKE QVDKVRAGKH GVRSAKQAIA IGLSEARRAG        60
     VAVKSPKKGT ASEATRKKAA TDNAAGQHKS ATKKSTESTA KRSRAATNAL KREGSAGASR       120
     AALSKQTKTA AAKRPAASRS AAAKKAAATK GAAGRSAAAK KAAQTRASRT HH               172
//

If you have problems or comments...

PBIL Back to PBIL home page