(data stored in ACNUC7421 zone)

EMBL: CP001053.PE343

CP001053.PE343       Location/Qualifiers
FT   CDS             395907..397322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4341"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bxe:Bxe_B0671 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4341"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18718"
FT                   /db_xref="GOA:B2TF43"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF43"
FT                   /protein_id="ACD18718.1"
FT                   /translation="MIELQLERDRRAAPTLVDQVVQGFARAIEGQSLRAGALLPSVRQL
FT                   AQSHDLSTFTVTEAYSRLVSMGLVVARRGSGYRVAARSQSARVAATDWQPPSITATWLL
FT                   SDVFADHSVPIKAGGGWLPNEWINETGLQHALRAMSRVPAARLGDYGHPYGFAPLRERI
FT                   AEQLDRRGLPVDVSNILLTQGATQGLDLIVRTLLRAGDAVIVEDPGYCNLLQILKLAGL
FT                   VVHGVPRTPAGVDTDVLEALVAEHKPKAIFVNTTLQNPTGATFGMSAAFRLLQIAERQR
FT                   MWVIEDDVSRELAPSGAPLFAAMEGLQRVLYVGGFSKTVTPGLRCGYVVAERAVLRELA
FT                   RTKMAVGLTSSEAIERIVDKVLLEGRYARHVEAVNERLKLAHATVEDRLDSLGLELFHR
FT                   PRAGLFLWARLPIEAERAGEVATAALTHGIWLAPGSYFRPDDAPSAWFRFNVPYSTDDA
FT                   LWRFIERVGQGTL"
     MIELQLERDR RAAPTLVDQV VQGFARAIEG QSLRAGALLP SVRQLAQSHD LSTFTVTEAY        60
     SRLVSMGLVV ARRGSGYRVA ARSQSARVAA TDWQPPSITA TWLLSDVFAD HSVPIKAGGG       120
     WLPNEWINET GLQHALRAMS RVPAARLGDY GHPYGFAPLR ERIAEQLDRR GLPVDVSNIL       180
     LTQGATQGLD LIVRTLLRAG DAVIVEDPGY CNLLQILKLA GLVVHGVPRT PAGVDTDVLE       240
     ALVAEHKPKA IFVNTTLQNP TGATFGMSAA FRLLQIAERQ RMWVIEDDVS RELAPSGAPL       300
     FAAMEGLQRV LYVGGFSKTV TPGLRCGYVV AERAVLRELA RTKMAVGLTS SEAIERIVDK       360
     VLLEGRYARH VEAVNERLKL AHATVEDRLD SLGLELFHRP RAGLFLWARL PIEAERAGEV       420
     ATAALTHGIW LAPGSYFRPD DAPSAWFRFN VPYSTDDALW RFIERVGQGT L                471
//

If you have problems or comments...

PBIL Back to PBIL home page