(data stored in ACNUC7421 zone)

EMBL: CP001053.PE346

CP001053.PE346       Location/Qualifiers
FT   CDS             399589..399789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4344"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18721"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF50"
FT                   /protein_id="ACD18721.1"
FT                   /translation="MKFSVKDEIRSDDIPTLEHAMKTVDADAKVNVDIDTKTVSVDSWL
FT                   MPEEFLVAFVDEDFDATIVEA"
     MKFSVKDEIR SDDIPTLEHA MKTVDADAKV NVDIDTKTVS VDSWLMPEEF LVAFVDEDFD        60
     ATIVEA                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page