(data stored in ACNUC7421 zone)

EMBL: CP001053.PE348

CP001053.PE348       Location/Qualifiers
FT   CDS             complement(400778..401656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4346"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: mlo:mlr1895
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4346"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18723"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF52"
FT                   /protein_id="ACD18723.1"
FT                   /translation="MQQRNYLVTAAAGKTGVHTVRHLLEGGHGVRALVHREDERSAALR
FT                   KAGAEVIVGDLLEHDDAIRATEGVSGAYLCYPVRPGFIQATAYFADAARRANLDVVVNM
FT                   SQISAREDSKSHAARDHWIAERVLDWSGVPTVHLRPTFFSEWLTFPWVRDPIVKEGKIA
FT                   LPYGNGRHAPISAEDQARVIAAILAQPSTHIGKTYPLYGPVELSQQEIADAVGNVSGRK
FT                   IVYSPTSIEDYRKHLETYGLPEFMIQHFLEVAIDYQNGIFAGTNDVIEKITGQAPQTID
FT                   AFVAANREAFQ"
     MQQRNYLVTA AAGKTGVHTV RHLLEGGHGV RALVHREDER SAALRKAGAE VIVGDLLEHD        60
     DAIRATEGVS GAYLCYPVRP GFIQATAYFA DAARRANLDV VVNMSQISAR EDSKSHAARD       120
     HWIAERVLDW SGVPTVHLRP TFFSEWLTFP WVRDPIVKEG KIALPYGNGR HAPISAEDQA       180
     RVIAAILAQP STHIGKTYPL YGPVELSQQE IADAVGNVSG RKIVYSPTSI EDYRKHLETY       240
     GLPEFMIQHF LEVAIDYQNG IFAGTNDVIE KITGQAPQTI DAFVAANREA FQ               292
//

If you have problems or comments...

PBIL Back to PBIL home page