(data stored in ACNUC7421 zone)

EMBL: CP001053.PE349

CP001053.PE349       Location/Qualifiers
FT   CDS             complement(401818..402390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4347"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cak:Caul_5130
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4347"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18724"
FT                   /db_xref="GOA:B2TF53"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF53"
FT                   /protein_id="ACD18724.1"
FT                   /translation="MRKSRVETAETRQRIVDVAARKFQLNGISATGLADVMSEAGLTHG
FT                   GFYRHFESKDQLVAEACATAATNIVATLEEAASDSDVEEGFRAIVERYVSTGHRDNVSG
FT                   GCPLAGMGSELSHGDENTRAAASQGFRDLVEVVAKRLDPQRSEATESKAVFAVTAMIGA
FT                   ITMSRILTDSDASASVLQQVKQHLDAI"
     MRKSRVETAE TRQRIVDVAA RKFQLNGISA TGLADVMSEA GLTHGGFYRH FESKDQLVAE        60
     ACATAATNIV ATLEEAASDS DVEEGFRAIV ERYVSTGHRD NVSGGCPLAG MGSELSHGDE       120
     NTRAAASQGF RDLVEVVAKR LDPQRSEATE SKAVFAVTAM IGAITMSRIL TDSDASASVL       180
     QQVKQHLDAI                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page