(data stored in ACNUC7421 zone)

EMBL: CP001053.PE350

CP001053.PE350       Location/Qualifiers
FT   CDS             complement(402574..403284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4348"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_4292 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4348"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18725"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF54"
FT                   /protein_id="ACD18725.1"
FT                   /translation="MSKSQKVVVVTGASQGIGAEVVKAFRKLDYRIVANSRSIKPSDDP
FT                   NILCIAGDIGDPATARRVITEGVARFGRIDTLVNNAGIYIGKPFTEHTAQDYAAVVNVN
FT                   MTGFFHITQLAVAEMEKHSSGHVVSVTSSTADNAISGGYSVLAALTKGGLNAATKSLAI
FT                   EYAKKGIRVNAVAPGIIKTPMHAPETHEALGAFHPLGHMGEASDIADAILFLDTAPFIT
FT                   GEILHVDGGQSAGR"
     MSKSQKVVVV TGASQGIGAE VVKAFRKLDY RIVANSRSIK PSDDPNILCI AGDIGDPATA        60
     RRVITEGVAR FGRIDTLVNN AGIYIGKPFT EHTAQDYAAV VNVNMTGFFH ITQLAVAEME       120
     KHSSGHVVSV TSSTADNAIS GGYSVLAALT KGGLNAATKS LAIEYAKKGI RVNAVAPGII       180
     KTPMHAPETH EALGAFHPLG HMGEASDIAD AILFLDTAPF ITGEILHVDG GQSAGR           236
//

If you have problems or comments...

PBIL Back to PBIL home page