(data stored in ACNUC7421 zone)

EMBL: CP001053.PE352

CP001053.PE352       Location/Qualifiers
FT   CDS             404332..405861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4350"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bam:Bamb_5788 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4350"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18727"
FT                   /db_xref="GOA:B2TF56"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF56"
FT                   /protein_id="ACD18727.1"
FT                   /translation="MTVPTPALTIEIDRQQQLPIYLQICERFRTAIAAGHLRPGDRVPA
FT                   LRGLATQLNTARGTVELAYTILVDEGYLQMRGAAGTFVSASLPASVTRSSRAQGVQAAR
FT                   ARQGAAGADSPQPPPESRDGRAAPRQAALTVAMSGEPRPLQPGLPALDAFPRKVWNRLV
FT                   AQRARSGERAMLAYPDPSGYRPLREHIATYLGLSRGVTCLPEQVFVTGGFRATLELVLR
FT                   SLARADDRVWFEDPGYLLARDFLTETGVQLVPVPVDGEGIDVERGTLLDAQARFAVVTP
FT                   SHQSPLGHTLSLARRMALLDWAGKASRWIIEDDYDSEFRYLGRPLPALKSLDRRDRVIY
FT                   CGTFSKVMFPGLRLAYVVVPERAVERVGKVAHSMNAGSPMLLQAAVADFIAQGHFARHL
FT                   KRMRALYAERRVLIVHALEKAFGERLIVDLPPGGIQFAVQFAEGPDGPVDDVAVAARAR
FT                   KAGLAVLPLSIWHANSRARRTRRGLVMGFANIADADEAGRLARTLRACLDG"
     MTVPTPALTI EIDRQQQLPI YLQICERFRT AIAAGHLRPG DRVPALRGLA TQLNTARGTV        60
     ELAYTILVDE GYLQMRGAAG TFVSASLPAS VTRSSRAQGV QAARARQGAA GADSPQPPPE       120
     SRDGRAAPRQ AALTVAMSGE PRPLQPGLPA LDAFPRKVWN RLVAQRARSG ERAMLAYPDP       180
     SGYRPLREHI ATYLGLSRGV TCLPEQVFVT GGFRATLELV LRSLARADDR VWFEDPGYLL       240
     ARDFLTETGV QLVPVPVDGE GIDVERGTLL DAQARFAVVT PSHQSPLGHT LSLARRMALL       300
     DWAGKASRWI IEDDYDSEFR YLGRPLPALK SLDRRDRVIY CGTFSKVMFP GLRLAYVVVP       360
     ERAVERVGKV AHSMNAGSPM LLQAAVADFI AQGHFARHLK RMRALYAERR VLIVHALEKA       420
     FGERLIVDLP PGGIQFAVQF AEGPDGPVDD VAVAARARKA GLAVLPLSIW HANSRARRTR       480
     RGLVMGFANI ADADEAGRLA RTLRACLDG                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page