(data stored in ACNUC7421 zone)

EMBL: CP001053.PE357

CP001053.PE357       Location/Qualifiers
FT   CDS             409401..409805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4355"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_C7168
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4355"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18732"
FT                   /db_xref="GOA:B2TF61"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF61"
FT                   /protein_id="ACD18732.1"
FT                   /translation="MTDITTSMKLNHMSFPSSDVSATATFFENHLGCTVAARGTSWFLK
FT                   RPGFDIVIDDAAGHPVEWPHNFHIGFELASLDEVRALYEQMAGAGVVMKTGVFKHERGS
FT                   RFFCEVPGGVLVEINTRSDADEKYRGTFDL"
     MTDITTSMKL NHMSFPSSDV SATATFFENH LGCTVAARGT SWFLKRPGFD IVIDDAAGHP        60
     VEWPHNFHIG FELASLDEVR ALYEQMAGAG VVMKTGVFKH ERGSRFFCEV PGGVLVEINT       120
     RSDADEKYRG TFDL                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page