(data stored in ACNUC7421 zone)

EMBL: CP001053.PE360

CP001053.PE360       Location/Qualifiers
FT   CDS             complement(411677..412609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4358"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: reh:H16_B0869
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4358"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18735"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF64"
FT                   /protein_id="ACD18735.1"
FT                   /translation="MNAIPLVVIGGYLGAGKTTLLNHILSNAGSRRITVLVNDFGSINI
FT                   DASLIRQRTDDVINLENGCVCCSIGGRLVEALLAISSRTDAPDLLIIEASGVSDPVRIA
FT                   QIGLLDRAFRLDGIVVLVDAERVEETLADPYVGDIAQRQIAGATAIVLNKMDLLGEPAR
FT                   EAVKARVEALANSRVIVQTTHAAVPLGLVFEEGHPLPARSIGAMPLSASPTPRDLCSFS
FT                   FVTNAYLSRKKLKEALRSFSAKLLRAKGFVRLESDGALHELHVVGNRVVIIASPARTCA
FT                   QSQIVLIGMFDREDESIARAALKAAEVGA"
     MNAIPLVVIG GYLGAGKTTL LNHILSNAGS RRITVLVNDF GSINIDASLI RQRTDDVINL        60
     ENGCVCCSIG GRLVEALLAI SSRTDAPDLL IIEASGVSDP VRIAQIGLLD RAFRLDGIVV       120
     LVDAERVEET LADPYVGDIA QRQIAGATAI VLNKMDLLGE PAREAVKARV EALANSRVIV       180
     QTTHAAVPLG LVFEEGHPLP ARSIGAMPLS ASPTPRDLCS FSFVTNAYLS RKKLKEALRS       240
     FSAKLLRAKG FVRLESDGAL HELHVVGNRV VIIASPARTC AQSQIVLIGM FDREDESIAR       300
     AALKAAEVGA                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page