(data stored in ACNUC7421 zone)

EMBL: CP001053.PE369

CP001053.PE369       Location/Qualifiers
FT   CDS             complement(422613..423374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4367"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bxe:Bxe_B0689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4367"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18744"
FT                   /db_xref="GOA:B2TF73"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF73"
FT                   /protein_id="ACD18744.1"
FT                   /translation="MIVQKLLPLLALMGVASYFQTITGFGLSMIVIGAASGLDLAPVTS
FT                   LAALLSLVTLANSATALPGKLHHIDWRAVGAATLGILPSVVAGVLVLDLLSNAASSMLQ
FT                   LLLGAVVLYGGLSAALRPTPLACRSGNRSFFVSGLFGGLLSGMFGVSGPPLIFQFYRQP
FT                   LSLVQIRYALIVIFTVTSTIRTMFSAYLGQLDADLWMQAAFAVPVVALMTLVARQYPPP
FT                   LSSVMTRRIAYAILVVIGGSLILHALQQLLR"
     MIVQKLLPLL ALMGVASYFQ TITGFGLSMI VIGAASGLDL APVTSLAALL SLVTLANSAT        60
     ALPGKLHHID WRAVGAATLG ILPSVVAGVL VLDLLSNAAS SMLQLLLGAV VLYGGLSAAL       120
     RPTPLACRSG NRSFFVSGLF GGLLSGMFGV SGPPLIFQFY RQPLSLVQIR YALIVIFTVT       180
     STIRTMFSAY LGQLDADLWM QAAFAVPVVA LMTLVARQYP PPLSSVMTRR IAYAILVVIG       240
     GSLILHALQQ LLR                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page