(data stored in ACNUC7421 zone)

EMBL: CP001053.PE371

CP001053.PE371       Location/Qualifiers
FT   CDS             complement(424554..426386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4369"
FT                   /product="sulfoacetaldehyde acetyltransferase"
FT                   /note="TIGRFAM: sulfoacetaldehyde acetyltransferase; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   thiamine pyrophosphate protein central region; thiamine
FT                   pyrophosphate protein TPP binding domain protein; KEGG:
FT                   bxe:Bxe_B0691 sulfoacetaldehyde acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4369"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18746"
FT                   /db_xref="GOA:B2TF75"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017820"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF75"
FT                   /protein_id="ACD18746.1"
FT                   /translation="MSEQNPSPRDATADNRASGPQAMTPSEAFVETLAANGVTDMFGIM
FT                   GSAFMDAMDIFAPAGIRLIPVVHEQGAGHMADGYSRVSGRHGVVIGQNGPGISNCVTAI
FT                   AAAYWAHSPVVIVTPEAGTMGIGLGGFQEAKQLPMFQEFTKYQGHVTHPARMAEFTGRC
FT                   FDRAMAEMGPTQLNIPRDYFYGQVKVEIPQPQRLDRGAGGEQSLNEAAELLAQAKFPVI
FT                   ISGGGVVMADAIEECKALAERLNAPVVNSYLHNDSFPANHPLWCGPLGYQGSKAAMKLL
FT                   SRADVVIALGSRLGPFGTLPQHGMDYWPTNAKIIQIDADHKMLGLVKKISVGICGDAKA
FT                   AAVALTERLAGRKLASDATREERGAQIASEKAAWEKELDDWTHERDAYSLDMIEEQKQE
FT                   RTPGGGTYLHPRQVLRELEKAMPEDVMVSTDIGNINSVANSYLRFNKPRSFFAAMSWGN
FT                   CGYAFPTIIGAKVAAPHRPAVSYAGDGAWGMSLMETMTCVRHNIPVTAVVFHNRQWGAE
FT                   KKNQVDFYNRRFVAGELDNQSFAAIARAMGAEGIVVDRLEDVGPALKRAIDAQMNHGKT
FT                   TIIEIMCTRELGDPFRRDALSKPVRMLDKYKDYV"
     MSEQNPSPRD ATADNRASGP QAMTPSEAFV ETLAANGVTD MFGIMGSAFM DAMDIFAPAG        60
     IRLIPVVHEQ GAGHMADGYS RVSGRHGVVI GQNGPGISNC VTAIAAAYWA HSPVVIVTPE       120
     AGTMGIGLGG FQEAKQLPMF QEFTKYQGHV THPARMAEFT GRCFDRAMAE MGPTQLNIPR       180
     DYFYGQVKVE IPQPQRLDRG AGGEQSLNEA AELLAQAKFP VIISGGGVVM ADAIEECKAL       240
     AERLNAPVVN SYLHNDSFPA NHPLWCGPLG YQGSKAAMKL LSRADVVIAL GSRLGPFGTL       300
     PQHGMDYWPT NAKIIQIDAD HKMLGLVKKI SVGICGDAKA AAVALTERLA GRKLASDATR       360
     EERGAQIASE KAAWEKELDD WTHERDAYSL DMIEEQKQER TPGGGTYLHP RQVLRELEKA       420
     MPEDVMVSTD IGNINSVANS YLRFNKPRSF FAAMSWGNCG YAFPTIIGAK VAAPHRPAVS       480
     YAGDGAWGMS LMETMTCVRH NIPVTAVVFH NRQWGAEKKN QVDFYNRRFV AGELDNQSFA       540
     AIARAMGAEG IVVDRLEDVG PALKRAIDAQ MNHGKTTIIE IMCTRELGDP FRRDALSKPV       600
     RMLDKYKDYV                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page