(data stored in ACNUC7421 zone)

EMBL: CP001053.PE375

CP001053.PE375       Location/Qualifiers
FT   CDS             complement(429989..431047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4373"
FT                   /product="taurine ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_B0694 ABC taurine transporter,
FT                   periplasmic ligand binding protein; TIGRFAM: taurine ABC
FT                   transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4373"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18750"
FT                   /db_xref="GOA:B2TF79"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF79"
FT                   /protein_id="ACD18750.1"
FT                   /translation="MKRHKNSTLRPWFQWTARCVLSLVCAATACFATTPAHAEDKEITI
FT                   AYQQIVDPWVVGIANGSIEKATGYKINWRQFESGAKVATALASGDVKVGVIGSSPLAAA
FT                   VSQGLDLQLFWILDNINQAEAMVVRNGSGITKPADLKGKTIGVPFVSTTHYHTMFALQH
FT                   WGINPSDLKILNMQPNQIVAAWSRGDIDAAYVWDPALAELKKSGKVLITSGDLSKLGKP
FT                   TFDGIAVDRKWGEEHKDFMAKLVKAIADADQQYRSNPSQWNASSPQAAAIAKMIGGSPA
FT                   DVPASLALYAFPTLSEQASAQWLGGGTTSRAALALKDTSEFLKSQKQIGTVLPDYSKFV
FT                   TPAYAEAAAQLK"
     MKRHKNSTLR PWFQWTARCV LSLVCAATAC FATTPAHAED KEITIAYQQI VDPWVVGIAN        60
     GSIEKATGYK INWRQFESGA KVATALASGD VKVGVIGSSP LAAAVSQGLD LQLFWILDNI       120
     NQAEAMVVRN GSGITKPADL KGKTIGVPFV STTHYHTMFA LQHWGINPSD LKILNMQPNQ       180
     IVAAWSRGDI DAAYVWDPAL AELKKSGKVL ITSGDLSKLG KPTFDGIAVD RKWGEEHKDF       240
     MAKLVKAIAD ADQQYRSNPS QWNASSPQAA AIAKMIGGSP ADVPASLALY AFPTLSEQAS       300
     AQWLGGGTTS RAALALKDTS EFLKSQKQIG TVLPDYSKFV TPAYAEAAAQ LK               352
//

If you have problems or comments...

PBIL Back to PBIL home page