(data stored in ACNUC7421 zone)

EMBL: CP001053.PE376

CP001053.PE376       Location/Qualifiers
FT   CDS             431369..432895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4374"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   bxe:Bxe_B0695 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4374"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18751"
FT                   /db_xref="GOA:B2TF80"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF80"
FT                   /protein_id="ACD18751.1"
FT                   /translation="MSSRTATALWTQRFQRPTDSNMSLQGQIRQMLVAAILDGQLPPQT
FT                   ALPSSRELADQLSVARNTVVLAYQQLVEEGYLISRERSGHFVNPAMLEGRHGFKAVHTV
FT                   PGSEQEHASARPDWAQRVQRRPSAQRNIVKPGNWQDYEFPFIYGQFDQSLFPTNDWREC
FT                   CMKSLSVMEIRNWAPDLIGRDDDTLIQQIRTRVLPRRGVFAMPDEIVITMGCQQALYLI
FT                   ADLLARERTTVGFENPGYPDARNIFENRNAQLIPLPVDEGGVRPVDDAHLFAQCDYVYV
FT                   TPSHQCPTTATMPIERRHALLELAQKHDFVLIEDDYESENNFSGLPHPALKSLDKADRV
FT                   IYIGSLSKTFAPGLRLGYIVGPRELVQELRALRRLMVRHPAAYIQRAFATFLSLGHHDA
FT                   LLRRLAHAYRERALALMAALDTHMPEARHIPITGGASCWVQGPPWLDAVRLADDAEQHG
FT                   ILIELGGVFFMDGLEQKNCFRMGFSAIKLDKIDAGVRLLAELVRKQKPAL"
     MSSRTATALW TQRFQRPTDS NMSLQGQIRQ MLVAAILDGQ LPPQTALPSS RELADQLSVA        60
     RNTVVLAYQQ LVEEGYLISR ERSGHFVNPA MLEGRHGFKA VHTVPGSEQE HASARPDWAQ       120
     RVQRRPSAQR NIVKPGNWQD YEFPFIYGQF DQSLFPTNDW RECCMKSLSV MEIRNWAPDL       180
     IGRDDDTLIQ QIRTRVLPRR GVFAMPDEIV ITMGCQQALY LIADLLARER TTVGFENPGY       240
     PDARNIFENR NAQLIPLPVD EGGVRPVDDA HLFAQCDYVY VTPSHQCPTT ATMPIERRHA       300
     LLELAQKHDF VLIEDDYESE NNFSGLPHPA LKSLDKADRV IYIGSLSKTF APGLRLGYIV       360
     GPRELVQELR ALRRLMVRHP AAYIQRAFAT FLSLGHHDAL LRRLAHAYRE RALALMAALD       420
     THMPEARHIP ITGGASCWVQ GPPWLDAVRL ADDAEQHGIL IELGGVFFMD GLEQKNCFRM       480
     GFSAIKLDKI DAGVRLLAEL VRKQKPAL                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page