(data stored in ACNUC7421 zone)

EMBL: CP001053.PE377

CP001053.PE377       Location/Qualifiers
FT   CDS             complement(432938..433690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4375"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bxe:Bxe_B0696 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4375"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18752"
FT                   /db_xref="GOA:B2TF81"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF81"
FT                   /protein_id="ACD18752.1"
FT                   /translation="MTKADTPTLRAFALLEHLVNSDGPVSLADIAQDVALPKASLHRML
FT                   ASLEAGGLVIREPGQKNAYVIGPRLAQLALGVVMHSGARRLRHAILARLVADLGETCNL
FT                   TMLHETEVLYLDRMEAPWPLRLDLKPGSHVPAYCSASGKLLLAMLPREQRSALVRALKL
FT                   ERFTQNTITDPELLEAELDRTAHKRIAIDNEEFLAGIVCVAAPVIDENGTCIAAIAVHA
FT                   PVSRAPLSRALEFVPRLQEAAKELAATF"
     MTKADTPTLR AFALLEHLVN SDGPVSLADI AQDVALPKAS LHRMLASLEA GGLVIREPGQ        60
     KNAYVIGPRL AQLALGVVMH SGARRLRHAI LARLVADLGE TCNLTMLHET EVLYLDRMEA       120
     PWPLRLDLKP GSHVPAYCSA SGKLLLAMLP REQRSALVRA LKLERFTQNT ITDPELLEAE       180
     LDRTAHKRIA IDNEEFLAGI VCVAAPVIDE NGTCIAAIAV HAPVSRAPLS RALEFVPRLQ       240
     EAAKELAATF                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page