(data stored in ACNUC7421 zone)

EMBL: CP001053.PE380

CP001053.PE380       Location/Qualifiers
FT   CDS             436696..438006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4378"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bxe:Bxe_B0699 major
FT                   facilitator superfamily (MFS)metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4378"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18755"
FT                   /db_xref="GOA:B2TF84"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TF84"
FT                   /protein_id="ACD18755.1"
FT                   /translation="MAIDPRAIRRVAFASVIGATVEWYDFFLYGVVAGIVFNKLYFPAS
FT                   DPLVSTLLAYSTFAVGFVTRPLGGVIFGHFGDRIGRKSALILTLIIMGISTAGVAFVPT
FT                   YAQIGIWAPILLLSLRVLQGIGLGGEWGGAVLMAYEYAPPEKRGLYASLPQIGLSIGLC
FT                   LASGMVAALSRLLPETAFLSWGWRIAFGASLGLVLIGLYIRAKVMETPEFIALKRNRRE
FT                   AKIPFVDMITRYRGAVVLGMGARYIDGVFFNIFAVFSIGYLTQHVSMSRTDALLGVMIA
FT                   AGVMCFFIPLFGSMSDKLGRARVYFWGSLICGVSVFPAFWLIEMQPANTLLIWAAIVVP
FT                   FGIFYAMVYGPEAALFAELFDAEVRYTGISFVYQFSGIFASGLTPIIATILMRLNGGKP
FT                   WTVCAYVLFSALVSALSVRAIERRRAGAFESVVHARS"
     MAIDPRAIRR VAFASVIGAT VEWYDFFLYG VVAGIVFNKL YFPASDPLVS TLLAYSTFAV        60
     GFVTRPLGGV IFGHFGDRIG RKSALILTLI IMGISTAGVA FVPTYAQIGI WAPILLLSLR       120
     VLQGIGLGGE WGGAVLMAYE YAPPEKRGLY ASLPQIGLSI GLCLASGMVA ALSRLLPETA       180
     FLSWGWRIAF GASLGLVLIG LYIRAKVMET PEFIALKRNR REAKIPFVDM ITRYRGAVVL       240
     GMGARYIDGV FFNIFAVFSI GYLTQHVSMS RTDALLGVMI AAGVMCFFIP LFGSMSDKLG       300
     RARVYFWGSL ICGVSVFPAF WLIEMQPANT LLIWAAIVVP FGIFYAMVYG PEAALFAELF       360
     DAEVRYTGIS FVYQFSGIFA SGLTPIIATI LMRLNGGKPW TVCAYVLFSA LVSALSVRAI       420
     ERRRAGAFES VVHARS                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page